SciAnts Media 
The-14Artificial intelligence and biology: AI’s potential for launching a novel era for health and medicine
#AI #Biology #Medicine #Healthcare #Innovation #TechInHealth #AIethics #DataScience #Genomics #Genetics #DrugDiscovery #HealthTech #Science
https://the-14.com/artificial-intelligence-and-biology-ais-potential-for-launching-a-novel-era-for-health-and-medicine/
✨ Bibliolater 📚 📜 🖋🇱🇧 Continuity and Admixture in the Last Five Millennia of Levantine History from Ancient Canaanite and Present-Day Lebanese Genome Sequences
"We show that present-day Lebanese derive most of their ancestry from a Canaanite-related population, which therefore implies substantial genetic continuity in the Levant since at least the Bronze Age."
Haber, M. et al. (2017) 'Continuity and Admixture in the Last Five Millennia of Levantine History from Ancient Canaanite and Present-Day Lebanese Genome Sequences,' The American Journal of Human Genetics, 101(2), pp. 274–282. https://doi.org/10.1016/j.ajhg.2017.06.013.
#OpenAccess #OA #Report #Research #Science #Genetics #Ancient #DNA #BronzeAge #Lebanon #Phoenicians #History #Canaanites #Academia
Biohacking PathwayCrazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
Wisdom in SpaceAdvances in genetic mapping continue, and someday it will be easy, cheap and detailed -- and will be able to be performed without the subject's knowledge. What privacy protections do people have for their genetic map, given that they leave copies of their genome in every dead skin cell that they leave behind?
-- Bruce Schneier (Wired News (Sep. 22, 2005))
⬆ #Wisdom #Quotes #BruceSchneier #Genetics #Privacy
⬇ #Photography #Panorama #CoyoteButtesNorth #TheWave #VermilionCliffs #Utah
Scientific FrontlineEpigenetics serves as the indispensable bridge between static genetic instruction and biological plasticity. It shifts the biological paradigm away from deterministic rigidity by detailing the exact molecular syntax of how the fixed hardware of our DNA is actively operated by the shifting software of our environment.
#WhatIs #Epigenetics #MolecularBiology #Genetics #Biochemistry #sflorg
https://www.sflorg.com/2026/04/wi04112601.html
#WhatIs #Epigenetics #MolecularBiology #Genetics #Biochemistry #sflorg
https://www.sflorg.com/2026/04/wi04112601.html
mymedschool🥛 Milk Sugar Malfunctions: Mastering Galactose Metabolism Disorders! 🥛
#USMLEStep1 #MedEd #Biochemistry #Metabolism #Galactosemia #Pediatrics #Step1Prep #HighYield #MedSchool #Genetics #Cataracts #Neonatology #FutureDoctor #StudyGram #MedTwitter
U01.01.107 Disorders of Galactose Metabolism: Classic Galactosemia vs. Galactokinase Deficiency
Master the clinical differences between Classic Galactosemia and Galactokinase deficiency with our U01.01.107 guide. Learn about GALT and GALK enzymes, the accumulation of galactitol, and the "emergency" presentation in newborns. Understand the risks of cataracts and E. coli sepsis. Essential USMLE Step 1 biochemistry available on mymedschool.org.
🍎 Sweet but Dangerous: Mastering Fructose Metabolism Disorders! 🍎#USMLEStep1 #MedEd #Biochemistry #Metabolism #FructoseIntolerance #Fructosuria #Step1Prep #HighYield #MedSchool #Pediatrics #LiverHealth #Genetics #FutureDoctor #StudyGram #MedTwitter
U01.01.106 Disorders of Fructose Metabolism: Essential Fructosuria vs. HFI
Master the clinical differences between Essential Fructosuria and Hereditary Fructose Intolerance (HFI) with our U01.01.106 guide. Learn the enzyme deficiencies (Fructokinase vs. Aldolase B), the pathophysiology of phosphate depletion, and why HFI is a medical emergency. Essential USMLE Step 1 biochemistry available on mymedschool.org.
ReDATA, University of Arizona🧬🌱Did you know that when plants combine #DNA from two different species (like cotton), scientists once thought the DNA would frequently “mix and swap” between them? Justin Conover and co-researchers found that this is actually rare. In most cases, the DNA stays the same, suggesting earlier methods may have overestimated this mixing. Learn more from their dataset & article at https://doi.org/10.25422/azu.data.24512896 & https://doi.org/10.1002/ajb2.16386. Image: Conover et al. (2024) CC BY 4.0 #Opendata #OpenScience #Genetics
Daniel Hoffmann 🌼A single nucleotide insertion in a non-coding region (enhancer Enh13) leads to formation of testes in female mice.
https://www.nature.com/articles/s41467-026-71328-9
#genetics
https://www.nature.com/articles/s41467-026-71328-9
#genetics
A single-nucleotide enhancer mutation overrides chromosomal sex to drive XX male development - Nature Communications
A single base pair insertion in the Sox9 enhancer, Enh13, mediates XX female-to-male sex reversal. This subtle non-coding mutation reconfigures transcriptional regulation, enhances Sox9 expression, revealing Enh13 as a binary switch governing sexual fate.